PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_021572-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 341aa    MW: 38439.3 Da    PI: 7.0929
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_021572-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-172774148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++  + G+g+W+ Iar+ g+ R++k+c++rw +yl
  AHYPO_021572-RA 27 KGLWSPEEDEKLMKYMVRNGNGCWSEIARKAGLQRCGKSCRLRWINYL 74
                     678*******************************************97 PP

2Myb_DNA-binding47.25e-1580123146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++ E+ l+++++  lG++ W+ Ia++++ gRt++++k++w++
  AHYPO_021572-RA  80 RGAFSPKEERLILHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 123
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6092274IPR017930Myb domain
SuperFamilySSF466891.4E-2824121IPR009057Homeodomain-like
SMARTSM007178.0E-122676IPR001005SANT/Myb domain
PfamPF002492.7E-152774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-232881IPR009057Homeodomain-like
CDDcd001671.01E-103074No hitNo description
PROSITE profilePS5129424.61775129IPR017930Myb domain
SMARTSM007174.4E-1579127IPR001005SANT/Myb domain
PfamPF002495.8E-1480123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2582130IPR009057Homeodomain-like
CDDcd001679.99E-1182122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGKNDDDENK KNKNKNVGEV MIMKMRKGLW SPEEDEKLMK YMVRNGNGCW SEIARKAGLQ  60
RCGKSCRLRW INYLRPDLKR GAFSPKEERL ILHLHSILGN RWSQIAARLP GRTDNEIKNF  120
WNSTIKKRMK ENKNKNKSST MEGEAQDNSS LVSGNAGYIM NQTEMLTFPS SLSFINTDHQ  180
IGGLASYNMM CMQMHDEDPL ISSSTSLSSN SSFDNSLPPL LDNNNFSCLQ PQPQPQPQPQ  240
PQDDSVYHHL QLLHDQIITP TATGSGIIMC NNHPIISNQN QNSWVDMIKS HPNGDMQDDY  300
YGNGIHSHTT GKVGSLKMGE WDSLDSLLGD VSFPFLDFQA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28221292108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010695283.12e-84PREDICTED: myb-like protein A
TrEMBLA0A0J8CYK02e-84A0A0J8CYK0_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.12e-62myb domain protein 46